McDonnell Genome Institute

Washington University

CircRNA

chr4|1916870|1939778|+|WHSC1|ENST00000312087.10

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9302

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

12

Peptide

SSSPSASLTENEVR

Amino Acids from 5' Exons

VRKRVHASITYSSLVTPQKELGYLRRASLLKEKDSLKNYARKVPSRHPRKLRKL,SEKECTPVSRTVLWRPRKSLDIEEPRSFRRRTVKIMPGKCQAGTHESEN,QKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIK

Amino Acids from 3' Exons

QRKICLMHVNHRSEIGLPRQHLQLLGLAKVHLLLHPLRM,NEKSVCMTTEEAKSGFHGSIFSSWVQKFISFCILNE,TKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENE