McDonnell Genome Institute

Washington University

CircRNA

chr4|185247293|185310816|+|SNX25|ENST00000264694.12

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9983

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

VVISHNMDK

Amino Acids from 5' Exons

SPVYGNSHESAQSRRVVISHNMDKALKE,VLCMETHMSQLSLEGFLIIWIKLKK,SCVWKLTVSSVKGSNFSYGSSER

Amino Acids from 3' Exons

VKKLRQKLISGPGTRGTSTNLWQRSSVRRESESWEALPMTSKRMGPWMRGKGLKAR,RNCGNESSPEGQEHEEVHQPTDCGKEAVEENPNPGRPCLPARGWGPGGGRASKPE,KETAAMKADLLRARNMKRYINQLTVAKKQCEKRIRILGGPAYDQQEDGALDEGEGPQSQK