McDonnell Genome Institute

Washington University

CircRNA

chr4|184788616|184803546|-|ACSL1|ENST00000281455.6

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

TMQAHELFR

Amino Acids from 5' Exons

GSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVS,VVVVHEDPHYLTATSPWCISMMMSQHYTKVSRGEYRCQ,WWCTKIRTTQRRALGVFLCHNIIRRFPEGNTGV

Amino Acids from 3' Exons

NSARTINTGQCKPMSCSGIFECQSWLTSDSTCVLFRPTRLWASELLQHSPPSGTPRDPNPSRHATSPCSQWKW,IQLRELSTQDNASPAVPVFSNARAGLPTVRAYSSDQHAYGLRSFCSTHHLLVRHETQTPEAAMRPLHAVSGSG,FSLENYQHRTMQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKPLKPPCDLSMQSVEVA