McDonnell Genome Institute

Washington University

CircRNA

chr4|184760356|184760500|-|ACSL1|ENST00000281455.6

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9846

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

15

Peptide

SEPVAQVFVHGESLQNGTLK

Amino Acids from 5' Exons

NGTLKIIDRKKHIFKLAQGEYIAPEKIENIYMRSEPVAQVFVHGESLQ,MAPKLSTGKSTYLSWHKENTPLKRLKISTCEVSLLLRCLSTEKAC,WHLENYRPEKAHIAGTRRIHSPKDKYLHAKACCSGVCPRRKPA

Amino Acids from 3' Exons

NGTLKIIDRKKHIFKLAQGEYIAPEKIENIYMRSEPVAQVFVHGESLQ,MAPKLSTGKSTYLSWHKENTPLKRLKISTCEVSLLLRCLSTEKAC,WHLENYRPEKAHIAGTRRIHSPKDKYLHAKACCSGVCPRRKPA