McDonnell Genome Institute

Washington University

CircRNA

chr4|183260909|183289635|+|WWC2|ENST00000513834.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9927

65

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

20

3

Peptide

SSLSASTLSMSSGSSLGSLASSR

Amino Acids from 5' Exons

PLCQHPVHVIWEQPGFPGIESGLSEHLQQRVTQLPQFHRTLLQQSKSDRCGLSVTGLPSAREKRLHSFWTHHHHPKRGGQVPPAWPEWTLWSGSCSNRPHSSTGGPEVCGLPVLEVLPFLLVSSRLSLGFGRHVSHVFFSCLSPSVHCLR,LSASTLSMSSGSSLGSLASSRGSLNTSSRGSLNSLSSTELYYSSQSDQIDVDYQYKLDFLLQEKSGYIPSGPITTIHENEVVKSPSQPGQSGLCGVAAAATGHTPPLAEAPKSVASLSSRSSLSSLSPPGSPLVLEGTFPMSSSHDASLHQFTADFED,SLPAPCPCHLGAAWVPWHRVGALTPPAEGHSTPSVPPNSITAVKVIRMWIISINWTSFCKRKAVTFLLDPSPPSMKTRWSSPLASLARVDSVEWQLQQQATLLHWLRPRSLWPPCPRGPPFPPCLLQALPWFWKARFPCLLLMMPLSISSLLTLKT

Amino Acids from 3' Exons

TVCQSVLRRTTQECPVRTSLDLELDLQASLTRQSRLNDELQALRDLRQKLEELKAQGETDLPPGVLEDERFQRLLKQAEKQ,RFASQSLEEQHRNAQCGHLTNWTFRHLPGRAASMMSCRRGTCGRSWRNKLRERLTFHQACWRMRGSRGFSKLRS,GLPVSPKNNTGMPSADISRLRTGPSGISDPAEPPQAAGAEGLAAEAGGTESSGRDPSTRRAGGEVPEASEASEA