McDonnell Genome Institute

Washington University

CircRNA

chr4|176687186|176729746|-|VEGFC|ENST00000618562.1

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9624

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

5

Peptide

EVPPPNMQAYASK

Amino Acids from 5' Exons

TQQMDSMTSVDQTRSWMKRPVSVSAERGFGLPAVDPTKNTETHASVSVKTNSSPANVGPTENLMKTHASVYVKEPAPEINPILENVPVNVQKVHRNACKERSSTTKHA,LNRWIPHLWTKQGAGRDLSVCLQSGASACQLWTPQRTRQKLMPVCLKQTLPQPMWGQPRIKHMPVCMKNLPQKSTPKSWKMCLMYRKSTEMLVKRKEVPPPNMQ,STDGFHDICGPNKELDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTESPQKCLLKGKKFHHQTC

Amino Acids from 3' Exons

AYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILK,LMQAKIWRSSYGLCPVMNSLYSTQNIGKCTSVSGKEAGNITENRPTSTQGQKRLNLLQHIIIQRSK,LCKQRSGGAVTVCVQCRTHDCTLPRILENVQVSAKERRLATQRTGQPQLKDRRDYKICCSTLYRDLE