McDonnell Genome Institute

Washington University

CircRNA

chr4|17588818|17595534|+|LAP3|ENST00000226299.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9897

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

8

Peptide

LNLPINIIDPSLGLR

Amino Acids from 5' Exons

TQVLDGTGNGIIPQCGQRIRAPSLLGNSLQRQPQCKRTTPGVCWERNYLQ,PKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFD,PSLGLRNRQWDHSSVWPKDLTSPQSSWKFTTKAAPMQTNHPWCLLGKELPLT

Amino Acids from 3' Exons

WWYLHQGFCKYGPHEGHGRSCNYMLSHRVCCKAFAHYY,GGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINII,VVSPSRLLQIWTSGLTWEELQLYAQPSCLLQSLICPLIL