top of page

McDonnell Genome Institute

Washington University

CircRNA

chr4|173333499|173333669|-|HMGB2|ENST00000296503.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9809

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

11

Peptide

GILQEVFGEMEGGR

Amino Acids from 5' Exons

VDADLSTWVKETPTSRGAKCPRTPSSCRPAGKSTRRNTRTLPSISRNSPRSVRRDG,WTRICQHGRRPQQAAGQNVLVRLLRADLPGRAQEETPGLFRQFRGILQEVFGEME,GRGSVNMGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWK

Amino Acids from 3' Exons

VDADLSTWVKETPTSRGAKCPRTPSSCRPAGKSTRRNTRTLPSISRNSPRSVRRDG,WTRICQHGRRPQQAAGQNVLVRLLRADLPGRAQEETPGLFRQFRGILQEVFGEME,GRGSVNMGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWK

bottom of page