McDonnell Genome Institute

Washington University

CircRNA

chr4|168415656|168422670|-|DDX60L|ENST00000260184.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9676

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

LDLIGDDK

Amino Acids from 5' Exons

VAAISKTVLETGRQDYGREMYFKTGQMSQLSPRPFIKSIIST,WLQSVKQYWKQADKIMEEKCISEKQADKCLNFLQDHSYKNQSYEVRL,GCNQNSTGNRQTRLWKRNVFLKNRLTNVSTFSKTIHIKINHMKLDL

Amino Acids from 3' Exons

IGDDKNKKKYSIDIGPARFQLQYMGHYLIRDERKDRDPRVQDFIPNAWQ,EMTKIRRNIRLTLDQLGFNCNTWAITEMKEKIGIPGSRILFPTHG,RRQKEEIFDHWTSSVSTAIHGPLLDKRKKRSGSQGPGFYSQRMA