McDonnell Genome Institute

Washington University

CircRNA

chr4|168400825|168472809|-|DDX60L|ENST00000260184.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9991

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

6

Peptide

IGAIHIK

Amino Acids from 5' Exons

VECGKKSWKCVHFSGEDRDKKPSPHMSLCLCNRSTKSEEDTEKD,FKNDDVGKRAGSVCTFLEKTETKSHPHTECHSYVFAIDEVLEKVRKTQKR,LRMMMWEKELEVCALFWRRQRQKAIPTLNVIVMSLQMKYLKKGRHRKG

Amino Acids from 3' Exons

RCHSHQMPFRCQNKSAIFNKFQLYSSTLPKKQQRW,GAIHIKCSHFRGVKINQPYLINSSSTLLPCSPRSSND,VPFTSNVAILEVSKISHIIPALLFYPVAQEAATM