McDonnell Genome Institute

Washington University

CircRNA

chr4|16006537|16018540|-|PROM1|ENST00000447510.6

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9338

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

21

3

Peptide

TGMPPRPPEAVSPTPEASSSWSIK

Amino Acids from 5' Exons

VAGWPGHLLSADPHRDFLLPGLTVWRVRLQACHPDHPRLCLQHRRRLPHG,WLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRGCVSNTGGVFLM,GWVAWSSALCPSSFFTTWAYCVACAAMTGMPPRPPEAVSPTPEASSSW

Amino Acids from 3' Exons

RSRRPKRRWRTTAPRACTNKVHSLAAVPAKLACGHLSMTLCAWCIHQVKPATASDCLASIATLNG,DQGDQRGVGEHEQHLEELAPTKYTAQQSDQRENPAVISQPSVLGASIKNLQQHQIVSKPAEQPTEA,IKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQ