McDonnell Genome Institute

Washington University

CircRNA

chr4|159193199|159241368|+|RAPGEF2|ENST00000505478.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

LMCETVR

Amino Acids from 5' Exons

VNVNCEIETRSKSFIL,LMCETVRYERHEANEVLY,CVKLDMRDTKQMKFYT

Amino Acids from 3' Exons

VDYMDENEEYFQRQASHRQSRRRFRKINQKGERQTIIDTVDPYPMGKPPLPRGYHT,WTIWMKMKNIFSGKLPIDSLEGDLEKSTRKVKDKQLLTLWILIPWANLLCLEAIT,GLYGKRIFSAASFPTVSKEIKNQPERKTNNYHCGSLSHGQTSFARLSH