McDonnell Genome Institute

Washington University

CircRNA

chr4|159186641|159241368|+|RAPGEF2|ENST00000505478.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

19

Peptide

QTIIDTVDPYPMGKPPLPR

Amino Acids from 5' Exons

DLEIVYSYLHGMEALSNLREHQL,IWKYIPIYMVWKPYQTGSINL,SGNSIFLFTWYGSLIKLEGAST

Amino Acids from 3' Exons

VDYMDENEEYFQRQASHRQSRRRFRKINQKGERQTIIDTVDPYPMGKPPLPRGYHT,WTIWMKMKNIFSGKLPIDSLEGDLEKSTRKVKDKQLLTLWILIPWANLLCLEAIT,GLYGKRIFSAASFPTVSKEIKNQPERKTNNYHCGSLSHGQTSFARLSH