McDonnell Genome Institute

Washington University

CircRNA

chr4|158713118|158715403|-|PPID|ENST00000307720.3

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9443

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

MSNWQGAIDSCLEVDK

Amino Acids from 5' Exons

IRGQFKGCYDSRSQAATYSFKLCTEYWCLTEDVKLAGSNQLFR,YVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLE,TWTVQRLLLRQQIEPSCNLLAVYILVLVNRCQIGREQLTVV

Amino Acids from 3' Exons

VDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVL,IKFYQKTKTLEILFSNPRTGRWLLKNMQKF,RNFINNRRLKKHWKYFFQIPELGDGYKICRSFK