McDonnell Genome Institute

Washington University

CircRNA

chr4|151149499|151175674|-|SH3D19|ENST00000409252.6

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9985

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

SNLRPIPR

Amino Acids from 5' Exons

ESNHPGQTGGFVRVPPRLPP,NPTTQVKQEVLCEYPQGCHR,IQPPRSNRRFCASTPKVATE

Amino Acids from 3' Exons

HYRHLSSLFSLSQQSRLAIFQQMWHLSSLIFLKNRIVQKTPVLQDVQCQNQDQKATSDQYPEILTLKSKVNRKSAQQPERSHPQAGPSLCWTTLAPQTVRQTLTQNKAKIVLFPELKCLRVRQTKPQDCPRNQKLLHVHFLQSLLFPQGNLLLPNQLLTELLESGTLGLRTDSRPPRKDSPHTLPCKKREASQPNLNCQRNQTLALYEVLILRFREEGPWLRALIVGRKCQLLPRGLCCRNLFPQKTPPTLQLHNLSLFLPDSQGHHKPKHTSHWEKGPQPTPQFQFCRASPWWTSISSALMMMFCPPHRGTWLKNLLVQRWF,TTGTSQASSAFLSSLVWQSSNKCGTFNRLYFRTELSRKPQCYKMSSAKTKIKKQPQTNTQRFSHRAKSTENQPSSRRRGVIPRPAPVSAGQRHLRQSGSDEHYEHRTKPKYCFQNSVGSDKHRNLRTAQETRNYSTFTSSKAYCFLRETFCSSQTSCQSFWRVGLWDEQTQGDLQGRTHPIPSPARSGKHPSNQTIAKETKPWPYTKCSDSGKRAPGELWEESANSCPAAFAAEEICFLRKPHLPFSSTETCHCSSPTRRGITSQSIQVTGRRAPSQPPSSSSAEQALGGHRSHQLCFAHPIGEPGRICWFRDGS,LQAPLKPLQPFSAVSSGNLPTNVAPLIVFDISEEPNCPENPSATRCPVPKPRSKSNLRPIPRDSHIKEQSQQKISPAAVGEESSPGRPQSLLDNASTSDSQAVMNIMNTEQSQNSIVSRIKVFEGQTNIETSGLPKKPEITPRSLPPKPTVSSGKPSVAPKPAANRASGEWDSGTENRLKVTSKEGLTPYPPLQEAGSIPVTKPELPKKPNPGLIRSVNPEIPGRGPLAESSDSGKKVPTPAPRPLLLKKSVSSENPTYPSAPLKPVTVPPRLAGASQAKAYKSLGEGPPANPPVPVLQSKPLVDIDLISFDDDVLPTPSGNLAEESVGSEMVL