McDonnell Genome Institute

Washington University

CircRNA

chr4|15007304|15040487|+|CPEB2|ENST00000259997.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

MGEDEPLLK

Amino Acids from 5' Exons

PLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQ,LFNSLPGATIRAVAGALEVCPGEQCMAEIIVEPETWESQELIRYLHRNRFLVMSHHRNLLAQLHHLQNLGLKIMCSEQTTIVIHSYPY,SSETVSLEQPSEQWLGHWKYVLGSNAWQRSSNRKHGNPRNYESDISIEETVFWCHSTTEIYSLNSITDSKILDRCVQNRQQYTLTLT

Amino Acids from 3' Exons

QGVMGEDE,KELWAKT,RSYGRRR