McDonnell Genome Institute

Washington University

CircRNA

chr4|148259977|148436862|-|NR3C2|ENST00000342437.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9211

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

AVEAMETK

Amino Acids from 5' Exons

LYFTKCFYWIFKTFKNMFGVWGGFRMPLWGSHLWQLQSFLQKSSG,STLRSVSTGSSRPSKICLVCGDEASGCHYGVVTCGSCKVFFKRAVE,LLYEVFLLDLQDLQKYVWCVGMRLQDAIMGSPVAAAKFSSKEQWK

Amino Acids from 3' Exons

RWRPKATTVSLKVIWKDGGVKFLRLWSVLPWDLQRGPMRITTWRLSTAVFPVLFQTTVLKEAAKKNKNYSLAFSKTIIGLGFHLILKLSWNLRNFQQLLSPWVYIWILEMLTIPMSSRTNKEAVQLRFIRMLNSWNFTKEMAIVLPLVVTRPDHLCLTLGAPMVASCAPLLKALSCVMRKARLFAALTHLRFAALLESTLCPPPQPALAVFQCTAQSPRELLHAPLMLKIEAPGRTALHMLAMWALLSQVRVANPQFPALQVTAVNLQSPVPIMSLDPLCLALQILTTQGALFPALRTLITDPRFPVRQPVLWDLSVALTMPSATLLLAPLLDPVHCGMWFPVQTRRRKVLKRSLFLRLRKRVPSQMVLASLILSSTNQNQMELLAAHVEEIAKIRILHSQYQSKNQPSIHVQAPLLKGIQQTRFHLWMARIFPLWMIKTIIPYQEFDHLCPALMVTVKAADSQWVLNKNQMMGAITQRPASLPLLLLGIQVDSPSTTGLVLKVQYLYHDRLETNLSNTVPFLLSILWSHGNHTATCRLEEVMGIRSNTFQKMYQ,DGDQRLPQSPRSRYGKTVGSSFSGCGAFFPGTYREDRELHGDCQRKLCFRCYSKQQYSRKQQRKTRTTPLPSARQSAWDFNIYNAGIGTFSNCSVHGFIYGFCKRCLFLAAEPTRKHESSDLSECTAGEILQRKWPSSFHSKLCEHALEIIYVLWELREWWRHARRCKPYHVSEKPVCLQPSEHDIFGLQPCWNQLCVLHHSQLWQFSSAQPNHPGNSSDMLPCKSRLQVAQPCTCQCGLSSLKSVKHEILNFQPSKSLQCKISSLQSQCHSEILCVPCKYQLKVLCFQPFEHQIHAFQSGSQYCGIYLPCKQCLQLHCFWHLCWIQYIAGCGSQSRHAGERCSRGPFSDGSRECHLKWCDWPAYCPVHKTRTRWSFQLMSRRKQNKFGFFILSTNKARINQAFMFRHLFRESNSKPVSIYGWLVFFLYGRLLFPIRNFRTTCARLWLRQRIPSGYTRTRWELLPRGQHPFLCYCWGEFRWTVLPLQDWCSRYNIFITIGRPIFPTPEFLSSCQYFSGVMEITRRPVVKKWVSGLRIHSRKCIK,METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNSTQGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYEQQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAVVKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPNVENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSPANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSAGSSTLRDVVPSPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSDSSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGFDGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVS