McDonnell Genome Institute

Washington University

CircRNA

chr4|147519850|147532704|+|EDNRA|ENST00000324300.9

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9913

41

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

LSPSGSCPLSWPFLKR

Amino Acids from 5' Exons

LLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVD,CWLGAGLLITMTLAYFFASCSPFCRSPRWGSPSSTSALLVLT,AGWALAFSQLWRISLQAVPLFAEVLGGDHRPQPLRSCQ

Amino Acids from 3' Exons

VQSSCLLESCSGNWDSFGNCHNCLHLDPVLYPGHSSDWLRHGTLIGTANLYAQCHIKIHG,YRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFME,TEQLPPGVVFRELGFLWLPLKLSPSGSCPLSWPFLKRLASSWYPLNIGVNSIKPVCSMPHQNSW