McDonnell Genome Institute

Washington University

CircRNA

chr4|139517884|139529220|-|SETD7|ENST00000274031.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9591

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

LCLLGTQGK

Amino Acids from 5' Exons

VDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYD,LTAGTGPLMGTPSPLMKKRSLMCLSPITTYPSTVPPWDTRQITPSLQTASTI,QQGLGPWEHPLPRNGHCAALPRIQVLCLLGTQGKSLLHSKLHLRY

Amino Acids from 3' Exons

DGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPG,MEEALEKMKMGRLERRPMCTLMRGPHFMGNLLMERKANWLPLCPLKKGGLTLNCLE,WRKPCRRSKRWGDDWREDSLCVPEDRTLWEIYWRDDRRQTGYPYVHRREASLTDAW