McDonnell Genome Institute

Washington University

CircRNA

chr4|1349523|1355245|+|UVSSA|ENST00000389851.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9516

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

GAGSSEEQLSR

Amino Acids from 5' Exons

VFRGAAEPRLPPADSTADPGARRDPSLSLPDCGGTLRQVSPVPDAGCFQLPGVPGAHAGHRPRTASAAPQGGGTEAEAGDHPGRGRVEEVWGGLQEACLGLPLLKTQQK,SSEEQLSRAYRLLIAQLTQEHAEIRLSAFQIVEELFVRSHQFRMLVVSNFQEFLELTLGTDPAQPLPPPREAAQRLRQATTRAVEGWNEKFGEAYKKLALGYHFLRHNKK,LQRSSAAPTACHSPRSTPRSVSQPSRLWRNSSSGLTSSGCWLFPTSRSSWSSRWAQTPHSLCRPPGRRHRGGRRPPGPWKGGMRSLGRPTRSLPWATTSDTTK

Amino Acids from 3' Exons

RFTRVGTHGGCLKRAIDLKAELELVLRKYKELDIEPEGGERRR,ASPASGPTVDVSVPLTRLNWSSYENTRSWTSSLREGKGA,LHPRRDPRWMFKACHPEGIGARTEKIQGAGHRAGRGKAQ