McDonnell Genome Institute

Washington University

CircRNA

chr4|122196634|122235023|+|KIAA1109|ENST00000264501.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9114

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

3

Peptide

IIDEIVCGSFSFHLTIK

Amino Acids from 5' Exons

RLFVEVFLSTLSSSESFNCTAWETKTDPCFITNEYYCRCYNFAVYQK,DCLWKFFFPPDYQVLKVSEIAQPGRPRQILAFELRMNIIADATIDLLFTKNR,IVCGSFSFHLTIKFKFLKLHSLGDQDRSLLLNYEILLQMLQLICCLPKI

Amino Acids from 3' Exons

VVVFMARYPEEEVKQMWLSRWLQILWWHSNWPRFLQTRVDTFQLCIFKHKCRVYVLWTVSATAWRMDNYRNSQNYR,LWFLWPDDILKNKRCRNKCGCLGGCRFFGGTVTGLDFFKLEELTPSSSSAFSSTSAESDMYYGQSLLQPGEWIITKEIPKIID,CGFYGQMISRIRGVETNVVVSVAADSLVAQLAISSNLKSHLPVALHFQAQVQSLICIMDSLCYSLENGLLKKFPKLM