McDonnell Genome Institute

Washington University

CircRNA

chr4|121911876|121933042|-|TRPC3|ENST00000379645.7

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9752

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

9

Peptide

LGSWSMEGSPSLR

Amino Acids from 5' Exons

LGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVTDYPKQIFRVKTTQFTWTEMLIMVWVL,WGKFCEALLSLHMQLLSSSSWVCLCSMPQTGSKASPRCPISQLLTIPNRSSGKPPSLHGLKCLWSGFL,GENSAKPFYEVCSTCSFFHHLPGSACVQCLRQVRRHHHAAQYHSYLSQTDLQGENHPVYMDNANYGLGS

Amino Acids from 3' Exons

VHGGKPIPETHDSDAGEGPAPGCQGPGLHVQPRHQPHRRGGALPRRRRVRQHPSGAQDAGGVQDAERQLRGLHGPERAAAGCGQRAPGGDRAAAQEGEPGAHWRRPAARHQQGLRAHRRGHPQPPWLRGQQASHSEPLAGAAGRRLLRLRRGRHALLAGHHPHHPGGALPEIRSGAHAADEGCQDRAAARLFLQVRGLHGEAEARLLQPLTLEDQCLQGAGQPGLPLIVQRGPGAYGPRAQQRAGQAGQHREGVQ,SMEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKRLTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEVVHMLLMKGARIERPHDYFCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIEKEFK,PWREAHPDAQCGRRAGARLSGARPSCSMTAAPASPPRRSASSTPPSTATSQWCARCWRSPRRTSTAWTTWARTRCSWLWATSTWRPSCCSRRRTWRALATPCCSPSARATCASRPSSTTLASRPASVSLAPVSRSCRTTTSTLTTRTARASRRTSPPSSWRRTARNTKWCTCCRVPGSSGRTTISASAGTAWRSRGTTPSATHARGSMPTRGWPARLTSHCPARTRCLRPSSATSWPSWPTRRSS