McDonnell Genome Institute

Washington University

CircRNA

chr4|119026626|119032027|+|SYNPO2|ENST00000307142.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.905

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

7

Peptide

KSGVTIQTIQWNK

Amino Acids from 5' Exons

TIQWNKGFDIKKQKPRASHTWGLCGKYHPADSTGHKDPVHRILPRPCQDSSPSEPKKWSRLCRQLERRNRPELPKGSPNALPKRTRGRRADLKGEGRSGTAWACGAATVPFTGETGRWPFSGSPGSKIVSPRPLVTQDCPHKFDPYESRPFPEVQQDNPDLQWQRVESDPGKSRRCGTAPGGSDPRLLQAEDRRVQASGRKGVCGFSSGRRAVRSTSFSGILCRLIRRHRAGRRSTLGKRSQQTSQAPSAAC,PSSGISEALISENENKNLEHLTHGGYVESTTLQIRPATKTQCTEFFLAPVKTEVPLAENQRSGPDCAGSLKEETGPSYQRAPQMPDSQRGRVAEELILREKVEAVQPGPVVELQLSLSQERHKGASGPLVALPGAEKSKSPDPDPNLSHDRIVHINSIPTNEKADPFLRSSKIIQISSGRELRVIQESEAGDAGLPRVEVILDCSDRQKTEGCRLQAGKECVDSPVEGGQSEAPPSLVSFAVSSEGTEQGEDPRSEKDHSRPHKHRARHA,HPVEVRLYLKMKTKTSSISHMGVMWKVPPCRFDRPQRPSAQNSSSPLSRLKFPLRTKEVVPTVQAAKKKQARATKGLPKCLTPKEDAWQKSSGRRKRYSLGLWLSCNCPFHRRDIRALVALWLSRELKNLSLLTQTLTCHMTGLSTIRSLLMRKQTLSGPARSRSPVAESESRKVKQEMRDCPGWKSSTALTGRRQKGAGFRQERSVWILQWKEGSQKHLLLWYPLPSHQKAQSREKIHARKKITADLTSTERGMH

Amino Acids from 3' Exons

GSGGVKACQKNKRKQNLNAKALPFFRMLPTPTPRGCCLRSDVGGPGNTPLATVLASLSERRTRRKKVTRRIHVKHFLVQANQRWMKSYCLTLTTTHKLTLTGILDWWTLKRNTEGTRWRCYQTPQAREPSCLPRGGREWIRSQPKKKRTRVERQAENKMLPRPMAEPRLLTKERRKSRERRALAKATSRVMVLAMFPNRMASVGHLRQQTSRGWSPIERPNPSQGLISQLPPSRQPETRVPLLTFLHLHLTLQSLLPLTPSPEGFQVRLLAQHSPLHGPSLPRGPSQPFTIRLSELPEMRGSQCQQKEQEYCRRPKGEARQNPCLLLKSPKAQILNSCHSFKIQKANGALELEVIPDRKKTTSAWGQRLVISCKAPLPNKRPLLLLLQNLQSSPHPPNQLQFPQSGLQEWLPPNLLPSPHPTHQRAPLSPPSKPSLLTLLPGLQVLTWLVPSKDHKQQPVRITHPNQQFPHQQSMLFSLVQWDHPMSFQEVGEELSSLLKGSREWRSMWSIQTRCRPTLLELSLPLHLSRPVGSTPPMSEHLLLWPIILSTRRLTHWLLSSLSHQLHSPPKWARKRERNPSMHMSSTNRISSMHPCLLSNLQMQRMASPRSHQSRSIQPWPSKLFLPGQMLPHLRMCRLRQCTRYQPIPLLLPSLQRPPHQSVHPQCLWAFPPRQSKNQPHHLILWHQGQSSQPRKVVSQF,AQEEKPVRKTSEGSKIMQKHCPSSNGCSQPQLQGGVDVEATSEGQEIHPSLRYWRAARGGRGGRRQGGYMSSISWCKRIRGGRVIVRRQHTSCELLGFWTGGHKETEQRGQDGDVTRHHRQGSPHVCQEEGENGSDHSPKRRGQGRWNAKQRTRCCPDRWPENHDFLPKKGGRVGKNAELCEQKLHRGESWSWPCSPTEWLQWDIDSKHPEDGPHENGQTLPRVCESASYPLLANPKHDESHCLSCTSTLLCSHSSPRLLQRGFKSDCWPSTAPSMAPACPVVPASLLRFVANSFPREDLSASKKNRNIAGGQKEKHDKTHVYFRAQSKPKSTLVTPSKFRRQTGHWSWRFRTGRRLPQLGGRGLFHAKLLCQTKDPSSCCSKTCSQVLILPTSNSSFPSLVSRSGSHPTSCLPHIQPIKGHRCLLHQNSPAFLPSCPACKYFERGWSLQRTTSSSSQSELHTQTNSFHTNSQCCSAWCSGTIQASRNEWERSSALCKAVENGEVCGRFRHGAGPRCSSSVSHSISPGQLEVLLQCPSTSSCGLSYPLAVLPTGCSQVSAISCTALQNGQEKGKETPQCIRCHEAPTVSAQCILVYFPTSRCKGWPPPEVISQGQFSPGHEASSSSPASECCLTYECAGFVSVLGTSLYLSSFLLCRGLLTSQCIPSACGHSHLAKARISLIILFCGTKAKVLSQEKWCHNS,LRRSESLSEKQVKEAKSKCKSIALLLTDAPNPNSKGVLMFKKRRRRARKYTLVSYGTGELEREADEEEEGDKEDTCEVAFLGASESEVDEELLSDVDDNTQVVNFDWDSGLVDIEKKLNRGDKMEMLPDTTGKGALMFAKRRERMDQITAQKEEDKVGGTPSREQDAAQTDGLRTTTSYQRKEEESVRTQSSVSKSYIEVSHGLGHVPQQNGFSGTSETANIQRMVPMNRTAKPFPGSVNQPATPFSPTRNMTSPIADFPAPPPYSAVTPPPDAFSRGVSSPIAGPAQPPPWPQPAPWSQPAFYDSSERIASRDERISVPAKRTGILQEAKRRSTTKPMFTFKEPKVSPNPELLSLLQNSEGKRGTGAGGDSGPEEDYLSLGAEACNFMQSSSAKQKTPPPVAPKPAVKSSSSQPVTPVSPVWSPGVAPTQPPAFPTSNPSKGTVVSSIKIAQPSYPPARPASTLNVAGPFKGPQAAVASQNYTPKPTVSTPTVNAVQPGAVGPSNELPGMSGRGAQLFAKRQSRMEKYVVDSDTVQAHAARAQSPTPSLPASWKYSSNVRAPPPVAYNPIHSPSYPLAALKSQPSAAQPSKMGKKKGKKPLNALDVMKHQPYQLNASLFTFQPPDAKDGLPQKSSVKVNSALAMKQALPPRPVNAASPTNVQASSVYSVPAYTSPPSFFAEASSPVSASPVPVGIPTSPKQESASSSYFVAPRPKFSAKKSGVTIQ