McDonnell Genome Institute

Washington University

CircRNA

chr4|113369513|113374946|+|ANK2|ENST00000505342.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9992

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

TTVVLGER

Amino Acids from 5' Exons

CDNSRNRNIRDSEGYDSTQLSQQDTGSHPCRGGEAVPPDPNIQRAGRLSHHTRTRRALRAQRGELSAENQPRNSGVCRPADLKTRRCSFK,VTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEK,QLQEQKHQRLRRLYPALPARHLRKLAPLQRRRSCTSRPQHPASGEALPSYKNPKSPQSTERRALRGKPASWSLPITSLRPVKDSMKMQLLK

Amino Acids from 3' Exons

VTLCEPSILSSTSQFQAEPVEGRRVSKVVKTTVVLGERMEKHLGDSSLATDLPSAKDDFEE,SLCVSPAFCPVPHNFRLSQWKAVESAKLLKQLWYLERGWRNIWGILVPLIFLQPKMTLK,HFVAQHFVQYLTISGASGRPSQQSCNNCGTWREDGETSGGFFSHSSFSQRLR