McDonnell Genome Institute

Washington University

CircRNA

chr4|113367565|113369805|+|ANK2|ENST00000264366.10

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9912

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

GTAQQQHSFPK

Amino Acids from 5' Exons

GSRYFKRSYALHSTSRKRSKLFLKKVRPAITLLSSQRKTFLLVIPLFRMASPKLRGTAQQQHSFPKLTRSKFNRISQGKCKTCLKSHLWNISRNI,VLGTSRGVMHCTAQAERGASCFRKDLRSPSYRLRGRHFCWLFHFSGWRPQNGGQLSNSTLSPNSQGASSTGFLRENARPARVISGISAGIF,FSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEY

Amino Acids from 3' Exons

CDNSRNRNIRDSEGYDSTQLSQQDTGSHPCRGGEAVPPDPNIQRAGRLSHHTRTRRALRAQRGELSAENQPRNSGVCRPADLKTRRCSFK,VTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEK,QLQEQKHQRLRRLYPALPARHLRKLAPLQRRRSCTSRPQHPASGEALPSYKNPKSPQSTERRALRGKPASWSLPITSLRPVKDSMKMQLLK