McDonnell Genome Institute

Washington University

CircRNA

chr4|105719059|105729499|+|GSTCD|ENST00000360505.9

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9324

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

LIGMFSLQQSAQR

Amino Acids from 5' Exons

VSQWTRLCELTIPLAIENFLRESSDQPPTIPVEILQLEKKLSEPVRVHNDDKLRRQKLKQQKADGVGPPLTKGKAKSKVHTQETSEGLDSSSKSLELKVAFSKLTVQEEPATTNREPSHIRKAKASDLPPLEHVFAEGLYFTLADIVLLPCIHHFL,LVSGPGYVNSPSLWLLRIFSENLLTSPQLYLKYYSRKSLVSLLECIMMINSAGRSSSNRRLMELGLPLLRERQRARSTHRKHLKGWILHPRVWNKWHSQSSQYRKNQLLPTESLLTSEKQKPPTFHLWSMCLQKGFTSLWQILCSCPVSIIS,SVDQAMTHHPFGYEFSQRIFPAPNYTCRNTTAREKAACSATPQAEAQATEGWSWASPYGKGKEQGPHTGNIRVGFFIQESGTESGILKAHSTGRTSYYQQRAFSHQKSKSLRPSTSGACVCRRALLHSGRYCALALYPSFL

Amino Acids from 3' Exons

EKGIEVMFSPHPCPTWTLDWNVLPAAVSPKE,KRALKCFLPTLALLGLLIGMFSLQQSAQRK,KGHSDVFSPPLPYLDSLECSPCSSQPKG