McDonnell Genome Institute

Washington University

CircRNA

chr4|105691975|105695668|-|INTS12|ENST00000340139.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9755

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

6

Peptide

MDVEPPK

Amino Acids from 5' Exons

ANDGGIWQSISRMSGVPSLPPRLSTPGDRQGSEPSPGVVLCPMYQTNEKN,QMMVASGNQLVECQECHNLYHRDCHKPQVTDKEANDPRLVWYCARCTRQMKRM,KWWHLAINNVRSAIISTTEIVINPRQTRKRMTLAWCGIVPDVPDKKE

Amino Acids from 3' Exons

DVEPPKISSTKNISIKQEPKISSSLPSGNNNGKVLTTEKVKKEAEKRPADK,MWSHPKFQAQKTFPLSKSPKYHPVFLLVIIMARSSQLKRRRKLKRDLLI,CGATQNFKHKKHFHARAQNIIQSSFWWQGPHNKGKEGSKETC