McDonnell Genome Institute

Washington University

CircRNA

chr4|105190359|105272918|+|TET2|ENST00000265149.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.956

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

QEMGSAAANRT

Amino Acids from 5' Exons

AGKHSAAHPLKIVYLPLLLLSYNAWKQEMGSAAANRTSRKSSKGLSC,LANIQQHTLSRLFTCLCSCVTTLGSRRWAQQQPIGHDPGRAVRDAA,WQTFSSTPSQDCLLAFAPVELQRLEAGDGLSSSQDMIQEEQGTELL

Amino Acids from 3' Exons

VCTLTREDNREFGGKPEDEQLHVLPLYKVSDVDEFGSVEAQEEKKRSGAIQVLSSFRRKVRMLAEPVKTCRQRKLEAKKAAAEKLSSLENSSNKNEKEKSAPSRTKQTENASQAKQLA,YALSLEKTIENLEENLRMSSFTFCLYTKSLTWMSLGVWKLRRRKNGVVPFRYVLFGEKSGCQSQSRLADKGNKPRKLQLKSFPPWRTAQIKMKRKSQPHHVQNKLKTQARLNSWQ,MHSHRRQSRIWRKTGAASRSAFIQSLRGVWECGSSGGEKTEWCHSGTEFFSAKSQDVSRASQDLPTKETRSQESCSKAFLPGEQLKKKGKVSPITYKTNKRKPGTVG