McDonnell Genome Institute

Washington University

CircRNA

chr4|103132692|103161457|-|CENPE|ENST00000265148.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9902

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

IIESIEDPK

Amino Acids from 5' Exons

EILKDFSESEFPSIKTEFQQVLSNRKEMTQFLEEWLNTRFDIEKLKNGIQKENDRICQVNNFFNNRII,KFSKISQKVSSLARLNFNKYVIGKKHSFWKSGILVLIKSLKMASRKKMIGFVKITSLITE,NSQRFLRKVPHKDISTSTKERNDTVFGRVVKYSFYRKAKWHPERKDLSSELLQNN

Amino Acids from 3' Exons

ESIEDPKQMKQTLFDAETVALDAKRESAFLRSENLELKEKM,KALKTQNKSRLCLMLKLPLMPRENQPFLEVKIWSRRK,KHRPKTNEADSVCNCSPCQERISLSKKSGAEGEN