McDonnell Genome Institute

Washington University

CircRNA

chr4|102639712|102664852|-|MANBA|ENST00000226578.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9921

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

LLPGLLLIK

Amino Acids from 5' Exons

VMQAQCVKTETEFYRRSRSEIVDQQGHTMGALYWQLNDIWQAPSWASL,CRPSVSKQKLNSTAVVAARWISKGTRWGHFIGSMTSGKLLPGLLL,DAGPVCQNRNILPPSQRDSGSARAHDGGTLLAVEHLASSFLGFS

Amino Acids from 3' Exons

IKRLKSHPSIIIWSGNNENEEALMMNWYHISFTDRPIYIKDYVTLYVKNIRELVLA,SRDNLILLSSYGVAIMKMRRRIGIISVSLTGQSTSRTMHSMKTSESSYW,QETEISSFYHHMEWQKGGADDELVSYQFHPANLHQGLCDTLCEKHQRARTG