McDonnell Genome Institute

Washington University

CircRNA

chr4|102593424|102612606|+|NFKB1|ENST00000226574.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9781

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

TLMDNYEIK

Amino Acids from 5' Exons

IKKKCRGNVRSSCPIFRIVSAVVVVLELEAEACLVVAVEEGALEVQVQ,RRSAEETSEAHAQFFGFRRWWCWSWRRRHVWWRWRRGHWKYRS,KEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGP

Amino Acids from 3' Exons

ETNSWLKMSCSCISYKFLIQTKTGLLWRRNVWGYLIMPSGVLLLPKHLWTTM,RHETAGRCEAAAVVTRNSSRQKLGYSGAEIRSGDTCLPAESCSFQNTYGQL,DMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYE