top of page

McDonnell Genome Institute

Washington University

CircRNA

chr3|9734130|9739958|+|BRPF1|ENST00000383829.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9279

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

14

Peptide

AAAPVVSVPCIPPHRCDSMGVDFDVK

Amino Acids from 5' Exons

MQHGGGLCEDFLPQLAGDATIRVPGGDLPKGLQELQWYVPPVPLPRQPTTPTTNSTPQAQEKGAPVTPSQQAVTQPLRGLTVTRPGDELCTGPAHGGGGLAWPRPPHQHLQPGCGVRGGSPRGGPEWQQQGEHDTSCYSQVRQTEQGEAQGLQPSPPPQCFCEHHSQAARGGLSGAGTGHPCPTPANFLLP,CDSMGVDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPPPPQQTPLRKHKKKGRQSRPANKQSPSPSEVSQSPGREVMSYAQAQRMVEVDLHGRVHRISIFDNLDVVSEDEEAPEEAPENGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVVYRELEQDTPDAPPRPTSYY,VTAWGWTLMRLSATTCGRLSHHTSARWRPAERSTRVTVVLSTTCTTMTTTTHHPHNKLHSASTRKRGASHAQPTSSHPAPQRSHSHQAVRAMHRPSAWWRWTCMAASTASASLTTWMWCQRMRKPPRRPLRMAATRRTLRHQLLLPSQANIRTRRSARTPTITTTTMFLRAPLPSCQRWSIGSWNRTPLMPHPGQLPIT

Amino Acids from 3' Exons

VHREVCRGAGRGSRVHGRGGLHLAGYHEASEDRGCKSHPAGDLVPNGPTGEGVVLESRRPCASGRGCCLLYLQWVPEQQCHPLLHVQPGRAPGVLRCPLYPGPVAVPPLPAVTLSCCGLCPVPQQGRCLQADRRALGPCGVCLVDPGLLRQHGLPRAYQHAHPTSSLEAHLLHLQTTGLRGLHPVPQGQLLHSFPCDMRPAGWPLHEDGACAGDRRQRHLFQCPQDSLLRHPHASRFSTPTACPVPQRGGGRGGGGGLELRESQEGQGQVPDQNEEGTEDPGREAGSSTCGVSALHPTTQ,YIEKSAEELDEEVEYDMDEEDYIWLDIMNERRKTEGVSPIPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMKMEPVRETGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSSEKVKKAKAKSRIKMKKARKILAEKRAAAPVVSVPCIPPH,TSRSLQRSWTRKSMTWTRRTTSGWISMSVGRQRVVPSRRRSLSTWTDWRRSRTLRVIIKATLMRWTRMLFAVSAMMVSARTAMSSSSVTCATWPCTRSATVSPISLRASGCAAVACSHPLVLWIVPCAPTRAVPSSRQMTGAGPMWCVPCGSLRSASPTRSSSLLTALSTSHQLAGSSPATFANNGAQGPASSATRPTVTQLSMHAPSRLAFTRWSLCGRQAPTAPLSVSARQPTATSTRLQVQHADCLPCPTARVRRMKMRRRMRVRAGAQRKSRRPRPSPGSKRRHGRSWQRSGQQHLWCQCPASHHT

bottom of page