McDonnell Genome Institute

Washington University

CircRNA

chr3|93892932|93910705|-|PROS1|ENST00000394236.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.999

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

7

Peptide

ITTGGDVINNGLWNMFVFALFK

Amino Acids from 5' Exons

IFSRIFPDIFRRRDTVRRIYRSLSVAPDCTSWWKDSSAETYIQNHNWRCYWSMEY,FSAEFDFRTYDSEGVILYAESIDHSAWLLIALRGGKIEVQLKNEHTSKITTGGDVINNGLWNM,FQQNLISGHMIQKAYCTQNLSITQRGSLHFVVERLKFSLRMNIHPKSQLEVMLLIMVYGI

Amino Acids from 3' Exons

FVFALFKLGYSLLHVSQLMLILTEAVSM,LSSLFSNWVIHCCTSVNCLSPKKLCQ,CLRSFQTGLFTAARQSTNAYPDLRSCVN