McDonnell Genome Institute

Washington University

CircRNA

chr3|88128808|88129826|+|RP11-159G9.5|ENST00000473136.4

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

YLSSENPLFFELR

Amino Acids from 5' Exons

TNIVLKIHCSLNYVPDTLLVNAYPKQWLLLNLVITQKSVKTYTSIKHSSHVCLCHLKISYSG,EQIFKFKSTVLTTCQIPNCLTHTRSNGSYILYKSPRNQRLILPSSTLHMSVYVTCRRSAIPG,NKYLSSENPLFFELRARYLIACERIPEAMALIKSCINHPEISKDLYFHQALFTCLFMSPVEDQLFRE

Amino Acids from 3' Exons

HLLKTDCKSGIDIICNAEKEGKTMLALQLCESFLIPQLQNGDMYCI,IYKLIVRVELISSVMLKKKAKLCPCNSVNPFLFHSSRMGICTVS,FIENLEWNYHLCKRRQNYVSLATLILSYSTAPEWGYVLYL