McDonnell Genome Institute

Washington University

CircRNA

chr3|88126133|88129011|+|RP11-159G9.5|ENST00000473136.4

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9501

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

YGNVNLELVTR

Amino Acids from 5' Exons

ECQNHLRRYGNVNLELVTRIIRDGGPWEDPVLQAVLKAQPASQEI,NARITSADMEMIWNWLESLEMVAHGKIQCCKLSLKLSQHLRR,MPESPPQIWKCESGTGDSNHRWWPMGRSSVASCPSSASISGD

Amino Acids from 3' Exons

TNIVLKIHCSLNYVPDTLLVNAYPKQWLLLNLVITQKSVKTYTSIKHSSHVCLCHLKISYSG,EQIFKFKSTVLTTCQIPNCLTHTRSNGSYILYKSPRNQRLILPSSTLHMSVYVTCRRSAIPG,NKYLSSENPLFFELRARYLIACERIPEAMALIKSCINHPEISKDLYFHQALFTCLFMSPVEDQLFRE