McDonnell Genome Institute

Washington University

CircRNA

chr3|88086256|88129826|+|RP11-159G9.5|ENST00000473136.4

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

SGIDIICNAEK

Amino Acids from 5' Exons

VVEDYAGRWQVPLPQLQVLQTALCCFTTASASFPDECEHVQYVLSSLA,WLKIMLEDGRSLCHSFRFFRLPFVVLQQPVHHSQMNVSMYNMFVALL,GRLCWKMAGPFATASGSSDCPLLFYNSQCIIPRMACTICFEPCC

Amino Acids from 3' Exons

HLLKTDCKSGIDIICNAEKEGKTMLALQLCESFLIPQLQNGDMYCI,IYKLIVRVELISSVMLKKKAKLCPCNSVNPFLFHSSRMGICTVS,FIENLEWNYHLCKRRQNYVSLATLILSYSTAPEWGYVLYL