McDonnell Genome Institute

Washington University

CircRNA

chr3|81581164|81642990|-|GBE1|ENST00000429644.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9238

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

SALLMQR

Amino Acids from 5' Exons

LLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQ,YLKSLKMKTGTWAIYTRSQTGATLKSALLMQRAMI,TRVRRLEHGRYSIHAHKQALPKVHCLCREPS

Amino Acids from 3' Exons

PLWNTRATRTGRHSSFHGYHSPLRCGTQPCFKKFSRWIEYVWDRFLLFSFWTRDSSLGQIVCLLQ,RYGTPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYS,VMEHLKSYKNWTQLIPWVSSSMWYTAMLQKIQQMDICLMGQIPVIFILDLEGLMIFGIADCLPTP