McDonnell Genome Institute

Washington University

CircRNA

chr3|78714396|78938927|-|ROBO1|ENST00000436010.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9184

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

AEASATLTVQGSR

Amino Acids from 5' Exons

INPRSYLENEGDSWHGFIHLCCRKYGGQSSICYSDCS,YEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQ,MKSEMIIPKLGRQLVTWVHTLVLQKIWWAKLKHLLLLFK

Amino Acids from 3' Exons

APVFVRKIFHLALLNTLQTLSQKENLQLTAKLKAAPHPLLNGTKGEREWRQTKMTLAHTECCCRVDLYFSYVYMDGKVDLMKESMSVQGITLERLATMHRWKP,LPSSSGRFSTSHCTPFRPDCLKRRTCNFELQSRPPHTHYMVQRGRESGDRQRPSLTPNVAAEWIFIFLTYSTWTEKTRSLCLCSKELPWRGCEPQCIAGSS,SRLRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVA