McDonnell Genome Institute

Washington University

CircRNA

chr3|66382272|66383401|-|LRIG1|ENST00000273261.7

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9098

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

KPWSGPR

Amino Acids from 5' Exons

MKPSCHQMFQATSLLRGPFLTDKKPWSGPRVALRPMGTLRAM,NRRATRCSKLPLFSGDPFPTRNRGQDRGWPSGQWAHEQ,ETVVPPDVPSYLSSQGTLSDRQETVVRTEGGPQANGHIESN

Amino Acids from 3' Exons

RPHPWWSPWKTVWYLWEKQWPSNAKPRGTLRPASPGSRGTARASLSGTTPLTTSSWWFRTWWQRMRADIPVRCPTPWARSELTASASCPQQAAGRMGPRASSPLLSAASSRHWSGCASSTRPGRRVKSTVSPTQ,DPILGGPLGRPCGICGRNSGPPMQSHGEPSAPHHLVQGGPPAEPHAAPLDPQPAPGGSERGGRGCGPIYLDVQHPGHGASSQPAERPARSRLQEGWDHGRHLHHCCREQHRPDVTGLGVHHLPDQEEERVQCHQH,TPSLVVPLEDRVVSVGETVALQCKATGNPPPRITWFKGDRPLSLTERHHLTPDNQLLVVQNVVAEDAGRYTCEMSNTLGTERAHSQLSVLPAAGCRKDGTTVGIFTIAVVSSIVLTSLVWVCIIYQTRKKSEEYSVTNT