McDonnell Genome Institute

Washington University

CircRNA

chr3|66377689|66380953|+|SLC25A26|ENST00000464350.6

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9539

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

LVPTAVAPSVSR

Amino Acids from 5' Exons

IICRCLPSNGSHQSGRFHLSGGLPNAQLAVGSWQKESLKQRQASPPLLSREGPAVQTLFRAAVTIGPSAEDQLCDTGMEIVPSVVAGWYEVIGLYARELREENGVCGGTLNNFLRTSISL,LFAGVFPRMAAISLGGFIFLGAYDRTHSLLLEVGRKSPSRDKPHLHFCQERGLQCKPSSAEQLSELAPVLKTSCAKIPAWRLCHPWYRLAGMKSLACMPESEKKTGSVAVLTISSEPLNKV,YLQVSSLEWQPSVWEVSSFWGLMTERTACCWKLAERVLEAETSLTSTSVKRGACSANPLPLSSCLNYRPQCRPVVLRYRHGDCAIRGIGWLVSHWPVCQRAKRRKRGLWRYSEQFPQNLLINKF

Amino Acids from 3' Exons

IQVLATDTPHGSYNYVQMSDATQASSQPLLPLFPVEIGMTRTEVDKTLFGANSSGTLCFPGSCPVSGVDSGLASHALGRWPLETSKYWASARSGLPEVNEDAGCSSVESGYNLAKVQEESPTRKERTCQTPTPFKQLPTHLLEDSQKLPFPSRDAIGFFFTAVSILSWLLGSDPWHSGQDPAAVLLHWCGECSWSLPPGSGPFGALGCALSLDTGWGWKACPLEQSTSVLQSLHTTRPPCSEGQRQRWVRVTAVGVFVPTQRTGCSAPLCK,SKSCERLILHMGVTTMYRVTLEPKLPRSLSYLSFPRLVQELRTKPSFLVPTAVAPSVSRGAVLSVAWTRDWRHMLWGGGHWKQASTGLPRALDCLKLMKMQAVALWSPGDTTLLKSRKNPLQGKNEPVRPPLDRLSSSQPTCKTVKSYLSHLEMPLAFSSQPSAFYRGYWGRATLGTRGRTQRQSCCTGDVENALGHSHPAPGHLAHLAVRCLWTQAGGGRLVPWSNSPLRCCSHCIRPGHRVLKDSAKDGLESLLWESSSPHRGQAAQLHCA,PSPVSDYSTWELQLCTDERLNPSFLAASPTSLSRRDWYDKNGRQNLAFWCQQQWHPLFPGELSCQWRGLGTGVTCFGEVAIGNKQVLGFRALWTASRCRLLCGVRVIQPCSPGRIPYKERTNLSDPHLTVAAPNPPVRRQSKVTFPIRCHWLFLHSRQHSIVVTGVERPLALGAGPSGSPAALVMWRMLLVTPTRLRAIWRTWLCAVSGHRLGVEGLSPGVTVHFGVAVTAYDPATVFRTAPKMGSHCCGSLRPHTEDRLLSSTVQ