McDonnell Genome Institute

Washington University

CircRNA

chr3|62516058|62550115|-|CADPS|ENST00000283269.13

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9476

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

IEGLEGGR

Amino Acids from 5' Exons

VLMKDIVTPVPQEEVKTVIRKCLEQAALVNYSRLSEYAKIE,FKILLPQCHKRRKQLSVNVWNRLRSTILGSQSMPKSK,FDERYCYPSATRGGKNSYPMSGTGCVSQLFSALRVCQNR

Amino Acids from 3' Exons

VWRVAEPSSMLSRRETPYLPVTMNKTASCGSRPCIGPRGSHTSLCPRPKSRNSTPREEMYLSWMPLSLNF,FGGWPSLLQCCQGGRHRDICQRTRPHPVGPGHVSGHGAVTQACAPDPSPETQRQGRKCTSAGCPYLSI,LEGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPPTQVQKLNAKGGNVPQLDAPISQF