McDonnell Genome Institute

Washington University

CircRNA

chr3|58168439|58169793|+|FLNB|ENST00000481470.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9994

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

11

Peptide

SSFLVDCSKAGIQSEFFINTTR

Amino Acids from 5' Exons

VSSRNSLLTPPEQVQGHYPSPSKAHPRLKWIARKHLKGTKSCTPPWLLVTTSASNTVGPTTSWAVPSRPRQVTNNHLRSYSPFLGSWLCQINHSGNYGWFMCSYFELMSVNSMRCQRAVFETYKSPQSGAVQKLRKHVRMLGGFLSLTGKNTYNLTYLFRSGSEKSPDFFSLEKSKSFPILIKMCLLQNTGKNTKLKPLHSHHPRPPTLIPSTRHDSLLHKECRFIAGKLENSDRKIILSHPQNHFLIFHYMSSQTFTLLIHRLFYVNRKMIPQAHLWWVGGGGIGRVLGLVSQGQTHPFAQKARSLYGGGILGVKTLWVDTGVVAFVLGCAGSPGVTVGTRLSSGETPLDLAIHACPPPSCILGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKA,YPVGILYHHPSRSRDIIRHHRRPIQGNGLPGNTRVQSHVHPHGSWLPDQRQIRWAQPHRGQSLQGQGDRRTTTFGVTLPSWGAGCVRSIIVETMDGFRCVKATLNFECQIVDVRGQCLKLTKVHRVEPCRSESMLGCVVFYLQERIHIEILRICLDQGLKNPLISNFHLKNNQKVFLYLKCVSSKTLEKIPNYENHFTATTQGNHHKHCSKSLPHVMIHCYIKNVGSSQENKIQIEKSSFLIHRIIFYFIICHPKLLHCLYIDYFMSIERCEFHRHIFGGGVGGLGGSLALSAKARLIHLPRKPDPSCMGVGSGFRRHYGCEIQVWWLLCWGARALLGLLCRVLACPLAERPLLIWPFMPVPLPPVSASVLALAQPTRPHPSWWSQPGRLQRPAIAPFPRHPRTPARPLRGQGSQRPLWARRVPSWWTAAKL,IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGNEQPPSELLSLPGELVVSDQSWKLWMVLDVLKLLTLNVSKYEMSEGSVNLQKSTEWSRAEVEKACDVRWFSISNRKEYILKSYVFVIRVKIPFLIFTKIIKKFSYTYKNVSPPKHWKKYQTMKTTSQPPPKVTTINTVVNPFHTSFTVTRMVHRRKIRKFRKNHPFSSTESFFDISLYVIPNFYTAYTTILCQKDVNSTGTSLVGRGWGDWEGPWPCQPRPDSSICPESQILVVWGWDPRGLEDIMGVRYRCGGFCVGVRGLSWGYCVGYSPVLWLRDPSSGHSCLSPSLLYLRPASSPWLSQRDLIHPGGVSDQVVYRDLLRHSQGILGRQQGDLGGRALKGLCGPEEFLPGGLQQS

Amino Acids from 3' Exons

VSSRNSLLTPPEQVQGHYPSPSKAHPRLKWIARKHLKGTKSCTPPWLLVTTSASNTVGPTTSWAVPSRPRQVTNNHLRSYSPFLGSWLCQINHSGNYGWFMCSYFELMSVNSMRCQRAVFETYKSPQSGAVQKLRKHVRMLGGFLSLTGKNTYNLTYLFRSGSEKSPDFFSLEKSKSFPILIKMCLLQNTGKNTKLKPLHSHHPRPPTLIPSTRHDSLLHKECRFIAGKLENSDRKIILSHPQNHFLIFHYMSSQTFTLLIHRLFYVNRKMIPQAHLWWVGGGGIGRVLGLVSQGQTHPFAQKARSLYGGGILGVKTLWVDTGVVAFVLGCAGSPGVTVGTRLSSGETPLDLAIHACPPPSCILGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKA,YPVGILYHHPSRSRDIIRHHRRPIQGNGLPGNTRVQSHVHPHGSWLPDQRQIRWAQPHRGQSLQGQGDRRTTTFGVTLPSWGAGCVRSIIVETMDGFRCVKATLNFECQIVDVRGQCLKLTKVHRVEPCRSESMLGCVVFYLQERIHIEILRICLDQGLKNPLISNFHLKNNQKVFLYLKCVSSKTLEKIPNYENHFTATTQGNHHKHCSKSLPHVMIHCYIKNVGSSQENKIQIEKSSFLIHRIIFYFIICHPKLLHCLYIDYFMSIERCEFHRHIFGGGVGGLGGSLALSAKARLIHLPRKPDPSCMGVGSGFRRHYGCEIQVWWLLCWGARALLGLLCRVLACPLAERPLLIWPFMPVPLPPVSASVLALAQPTRPHPSWWSQPGRLQRPAIAPFPRHPRTPARPLRGQGSQRPLWARRVPSWWTAAKL,IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGNEQPPSELLSLPGELVVSDQSWKLWMVLDVLKLLTLNVSKYEMSEGSVNLQKSTEWSRAEVEKACDVRWFSISNRKEYILKSYVFVIRVKIPFLIFTKIIKKFSYTYKNVSPPKHWKKYQTMKTTSQPPPKVTTINTVVNPFHTSFTVTRMVHRRKIRKFRKNHPFSSTESFFDISLYVIPNFYTAYTTILCQKDVNSTGTSLVGRGWGDWEGPWPCQPRPDSSICPESQILVVWGWDPRGLEDIMGVRYRCGGFCVGVRGLSWGYCVGYSPVLWLRDPSSGHSCLSPSLLYLRPASSPWLSQRDLIHPGGVSDQVVYRDLLRHSQGILGRQQGDLGGRALKGLCGPEEFLPGGLQQS