McDonnell Genome Institute

Washington University

CircRNA

chr3|58106679|58125743|+|FLNB|ENST00000295956.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.969

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

7

Peptide

MSSPWLPGFAIEGPSQAK

Amino Acids from 5' Exons

GLPLKAPLRQRLSTTTRMMDRVMSNTGPRSLANMLFTSCVTTKTSRTARTWPSSTQPREATTLI,VCHRPLSGKDVQRPEWIVCQILAQGAWRICCSHHVRRRHQGQPVHGLHPPSHGRLQPS,FAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDL

Amino Acids from 3' Exons

VSMWRHMMTCLSQTVPSRWLSLKAASHLGCKPKDLDKRPLPTSPMSSPWLP,SPCSGGDIRAYPKQSLQGGCHRLPAIGASPRTWIERGLYQQAQCLHRGYQ,LHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVT