McDonnell Genome Institute

Washington University

CircRNA

chr3|58098710|58121503|+|FLNB|ENST00000295956.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9882

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

3

Peptide

SQQGAGVGDIGVEVEDPQGK

Amino Acids from 5' Exons

ELVWVTLVWRWKIPRGRTPWSCSWKTKETRCIDVCTNPCSLALTWSRSSLLGTLFLRVPSLCRLGK,SWCGHWCGGGRSPGEEHRGVARGRQRKPGVSMCVQTHAAWPSRGQDLLCWGHYSESLRCAGWG,AGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGE

Amino Acids from 3' Exons

GWKLGRIRSSPLIPGGQEARGSWTQSSAPLGRSCHAHLQAGRTARPSSSLGRRGCMLTPTMDTLCPGAPTQWRPRCHQIPA,GGSWEGSGVHRYQGGRRPGEAGRDNPQPLSEGRAMPSDTCDRPGEQHGQVHPSGGGAVCCRRDLRWTPCAREPLHSGGLAATRSQQ,VEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSK