McDonnell Genome Institute

Washington University

CircRNA

chr3|58077045|58109322|+|FLNB|ENST00000295956.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9609

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

8

Peptide

EHPAQPLQDSK

Amino Acids from 5' Exons

IAKPLWMGTSSSWVWCGRSSTTPSPCPCGRMKGMMMPRSRRQSRGCWGGFRTRSPTCPSPTLTRTGKTAKPWEPWTAVLQ,QSHCGWEPEAHLGSGVDADPPLLHLHARVGGRGCQEADAKAEAAGVDSEQDPLLAHHQLPELARRQSPGSPGRQLCS,SKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP

Amino Acids from 3' Exons

DGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYR,MGKANALTSRRTGWTAHMHAHTPRRPSSTPLLWSGEATSRTAPT,WGRPTHHPDEEPDGRHICMLIHPGEGHQAHHCCGLGRREHPAQPLQ