McDonnell Genome Institute

Washington University

CircRNA

chr3|57334781|57363786|-|DNAH12|ENST00000495027.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9985

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

MMSNEITK

Amino Acids from 5' Exons

GKERDIPGTDVSFNWRSKSKCEKSSNLATGQKLGGNLSGKISCLQRTQ,ARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGL,QGKRLNTRNCFFLEEVLKVLRKILIQLGYRTKAGRKSVGQVNFLPSEDS

Amino Acids from 3' Exons

TRIRRGTKCPDSSVCSQETAERHREKNFRNIIIIRRKHFRRKCNSLRLCQNDVQNNKETA,PELEEERNALILQSAANKKQLKDIEKKILETLSSSEGNILEDESAIKVLDSAKMMSNEITKKQQ,QNKRNEMPFFSLQLTRNSKTRKKFKHYHHQKETFKMKVQLKSTLPKCPMKQRNS