McDonnell Genome Institute

Washington University

CircRNA

chr3|56571180|56615272|+|CCDC66|ENST00000326595.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.985

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

NLGDEQVALK

Amino Acids from 5' Exons

MNRLLRRKKKKFLKNGMILGKNLKVIKYGKNIKFLTNL,TGCFKEERKRSFKMESLEKIKNNMGKTSNSPI,EQVALKKKEKEVSEKWNDPWKKSESDKIIWEKHQILDQSR

Amino Acids from 3' Exons

EIMTLKTNELFQTMQRAQELAQRLKQEQRIRELAQKGHDTSRLIKNLG,KSLSRQMSYSRQCSEHRNWHRDNKNKESENWRKRDMTLLDLKILV,NHDSQDKAIPDNAASTGTGTETKTRTKNPRIGAKGTHFTDKSW