McDonnell Genome Institute

Washington University

CircRNA

chr3|53229006|53242242|-|TKT|ENST00000296289.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9632

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

9

Peptide

AVELAANTKPPHVMLQRR

Amino Acids from 5' Exons

GKTGPPRWPKIWLCFGQSPHQLSFTQVMALLQRRQWNPPIQ,GRRALPDGPRRSGYVSVSPHINCLLPKWRCYREGSGTSRQYK,EDGPSQMALEDLAMFRSVPTSTVFYPSDGVATEKAVELAANTK

Amino Acids from 3' Exons

PPHVMLQRRRDHGCPLFPHHALQVPGPPESAQPLCALQ,HPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDRFVLSK,TPRHAAAPQRSWLSSFSTPCATSPRTPGIRTMTALCSP