McDonnell Genome Institute

Washington University

CircRNA

chr3|53185603|53186340|+|PRKCD|ENST00000330452.7

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

21

Peptide

VLTLAAENPFLTHLICTFQTKR

Amino Acids from 5' Exons

RASRRSDSASSEPVGIYQGFEKKTGVAGEDMQ,EPPGDQTQPPQSLLGYIRVSRRRPELLGRTCK,SLPEIRLSLLRACWDISGFREEDRSCWGGHA

Amino Acids from 3' Exons

VLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK,CCLESRAEESTLPSRPSRRMWSSTTTWSAPWLRSGCHLPQRIPFSPTSSAPSRP,AAWRAEGQRRVLCHQGPQEGCGPDRRRRGVHHGEAGADTCRRESLSHPPHLHLPDQ