McDonnell Genome Institute

Washington University

CircRNA

chr3|53181443|53186340|+|PRKCD|ENST00000330452.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9652

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

IANSLCAVR

Amino Acids from 5' Exons

IANSLCAVRTRPSSQRTAAEPSNRPKSTTSRTMSLSPPSLGNPPSVLCAKTLS,LQTVYAQGRGQVPNDEPPRSHQTGQNPLHQEPVYRHLLWATHLLFCVQRLCL,CKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFV

Amino Acids from 3' Exons

VLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK,CCLESRAEESTLPSRPSRRMWSSTTTWSAPWLRSGCHLPQRIPFSPTSSAPSRP,AAWRAEGQRRVLCHQGPQEGCGPDRRRRGVHHGEAGADTCRRESLSHPPHLHLPDQ